DPCstruct | MC25287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 134 ± 14 aa |
| Standard deviation of domain lengths | 14.47 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.77 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF15294- CL0079 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7MCN2 | 2-134 | ADLGLSDHHQSCMGGYLRFTKYQRAQRLRSVDACFQDVKDTRLLEETYTSDEVVELLDSLAEVVRAEVEGELIHATHTNSVLLSNVF… |
| A0A2G8KML9 | 2-127 | SSNLGLNEHHHDVVLNYLRFARYKRSQNLRGWEGCFQDVKDSRLTEDTFTSDEVEDILDGLEAVVRGEVESELININHTNVLLLRQF… |
| A0A2P6MZ02 | 7-140 | None |
| A0A507FI17 | 1-137 | None |
| A0A6L2PCJ9 | 18-124 | None |
| A0A1J4J4A4 | 8-168 | None |
| A0A7R8HCN6 | 352-498 | None |
| Q7ZXF9 | 1-142 | None |
| A0A0M3KCD9 | 18-153 | None |
| A0A2R7WIM9 | 14-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.