DPCstruct | MC25286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 349 ± 53 aa |
| Standard deviation of domain lengths | 53.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HH77 | 1-248 | MRFMRLLQKSTLHEQIQAMNAIVHAMVIALNPSSPVPFVNGAVAIWKRLENVVPRSLCEATVCAWSTDELNHDMLIEQPLFLFRCDE… |
| A0A3R7LSY6 | 14-419 | VLDRLMRMPPHQVWPLAAPITASIKCLLQPGVPRKVLDTYRQVWMRLNSLFPRRLWAMSVEGLQPEQPQSKLRKALTEDDIILDPLY… |
| F0WBI7 | 720-1110 | None |
| A0A1S8W8G5 | 631-884 | None |
| A0A7R9B1S8 | 25-427 | None |
| E5QCH1 | 782-1155 | None |
| U9SL78 | 352-668 | None |
| A0A3P7EFB2 | 228-576 | None |
| A0A6V7UD18 | 397-744 | None |
| A0A0R3RMK8 | 2-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.