DPCstruct | MC25284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 180 |
|---|---|
| Mean domain length (aa) | 250 ± 52 aa |
| Standard deviation of domain lengths | 51.92 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 16.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06985 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0WT75 | 15-213 | IAPISFIDSDMLCVRGAYIDRVKDTIPNTGPDVATVRAVGQEKGRKWAIESQHKYCMGGTYAEAIQRNIVFDLVYDDLGRPTQRGGR… |
| A0A428TYT2 | 255-489 | FSKIMLREREIKKPIMKINDEKNELTIQGVFFDTLIDIGTLFTNPDLSNENPTTENQTLLEAVAFVSQLKQAGSEYNVFTALWKSLV… |
| A0A219ARG4 | 50-342 | None |
| A0A6A5V069 | 79-381 | None |
| A0A3M9Y171 | 32-268 | None |
| A0A1L9UP54 | 254-554 | None |
| A0A395T1J5 | 823-1144 | None |
| A0A395T3V2 | 427-693 | None |
| A0A0D2Y9R9 | 55-296 | None |
| A0A5C6ST66 | 890-1196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.