DPCstruct | MC25283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 186 ± 20 aa |
| Standard deviation of domain lengths | 19.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A168KTI5 | 2-156 | ALQYPEDVMVEIEDFARYFPQDAVHPSLALLALHLWLDIMGHETRMKEPFIQSGSDVGDVDLGVFILYFPHYLRYTENQRHLHYLHP… |
| A0A428TY50 | 7-193 | LVLLKGSRRQPGFLYKAPYMANLLYPSLLLYELQQFSSAHPNDSLPMKSMLFAVQLWCDIKTHPRLQKEAFLVGGQEIQDVSVDEFI… |
| A0A2H3ID25 | 1-198 | None |
| A0A366Q0F0 | 176-374 | None |
| W9IIH8 | 260-455 | None |
| A0A2P4ZSP2 | 290-510 | None |
| A0A0J9WL72 | 272-463 | None |
| A0A098DUK6 | 281-451 | None |
| G0RCQ8 | 142-311 | None |
| A0A0I9XBF8 | 167-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.