DPCstruct | MC25282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 264 ± 27 aa |
| Standard deviation of domain lengths | 27.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9NWI3 | 1-269 | MSSNKPTRKFSTGATSHRKRQMSLLVEKDGHVNAPLQTLYLGISAVFADDHTAVIALAIHDTVYLNDFSIKHISLDEDMREGQDLIA… |
| A0A428TPC6 | 11-277 | TGATSHRKRQMSLLVEKEGPVSAPLQTFYLGISAVFADDHTAVIALAIHDTVYLNDFSIKHISLDEDMREGQDLIADHIISEVETYE… |
| A0A420YHX6 | 180-460 | None |
| A0A1Y2IB02 | 9-321 | None |
| C9SCE5 | 3-259 | None |
| A0A1J8QPR2 | 6-310 | None |
| A0A178F3H5 | 4-287 | None |
| A0A094KNQ6 | 1-258 | None |
| A0A421DHL9 | 550-800 | None |
| A0A0C3Q3H5 | 2-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.