DPCstruct | MC25281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 7.21 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428ST54 | 1-116 | MPIFRLFDPSHPDPTSSGMVSNGKTTTYACVYAFTDRLLHLTAARGEQPVVEAWSQCLQGPALVWHSQILTPEDRTQLQYGPVKTIT… |
| A0A5M8PB58 | 278-372 | WKPHDIGIFWPNIPASYGTGDVIDDGKEQYYRNVHSFIVRIRVAVLTRDTAMMRQNLDLCLKGEAQDWWTKQLAHVTRVGIMSDNTG… |
| A0A1V6T0H5 | 114-211 | None |
| A0A165F774 | 17-112 | None |
| A0A2J6SQJ2 | 1-117 | None |
| A0A1J9QK31 | 98-202 | None |
| A0A5M8PR19 | 71-169 | None |
| A0A1W5DDJ8 | 411-517 | None |
| A0A1W5CTB4 | 151-251 | None |
| A0A7T7BPE6 | 77-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.