DPCstruct | MC2528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 302 ± 28 aa |
| Standard deviation of domain lengths | 27.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812ZNM7 | 302-582 | KWTKWFYASANPTLAKTFNMVTTTLEDLVRVQCVPKSDLHGSSFRSTANYLPEEVELRNLLQVKKKWMSAGTAAEMRQVAAVQTLLV… |
| A0A812YCX6 | 142-435 | DAERRAQKNEMRAPTSICAGAIKSGWVRSPLEKVSLESQDWTSAVRANKLRSSILPNARSGKKDLGLNMTELTASKACPHMTKPHVL… |
| A0A812YAR7 | 391-718 | None |
| A0A812JHB3 | 281-541 | None |
| A0A812KBZ6 | 149-451 | None |
| A0A813AP82 | 1-346 | None |
| A0A2D5E161 | 149-484 | None |
| A0A812YHG6 | 177-465 | None |
| A0A812MI09 | 431-696 | None |
| A0A812NRI7 | 255-572 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.