DPCstruct | MC25277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 213 |
|---|---|
| Mean domain length (aa) | 220 ± 41 aa |
| Standard deviation of domain lengths | 41.10 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.96 |
| Pfam Score | 52.29 |
| Assigned Pfam label(s) | CL0200- CL0529- PF08331- CL0344- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9K322 | 86-325 | SLKPTGIGGDLSNSLHNAQSIKALGYYLGADFVGICKAEPFMYYSHDEVDGQPIDPYHEYAVVMLIDQGFETMEGASGDDWISASQS… |
| A0A1W9XC41 | 4-221 | HMKTEMIQAVIGKAEKTGASLAGIAGIDDIKASPSYEIHKKTEWPENARSVLVVGLEHPKSEPSLDWWDRGKGGTPGNRKLMAMADS… |
| A0A6I9YCD7 | 5-170 | None |
| A0A2G8L118 | 103-329 | None |
| A0A1G3MZL9 | 23-222 | None |
| A0A1X6PHQ4 | 66-436 | None |
| A0A343TNQ6 | 223-483 | None |
| A0A7Y3CR36 | 1-154 | None |
| A0A1M6Q642 | 123-353 | None |
| A0A1G3YJX5 | 16-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.