DPCstruct | MC25275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 144 ± 18 aa |
| Standard deviation of domain lengths | 17.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4LXH5 | 531-672 | NFAESSRPRRGFKESLKTKNTKIGRPRTKKATVAQRMNWMQPHIFEQIDAATKATGYPWRPVDIVQRLQRSNPRVFANLKHQRLSEW… |
| A0A409YTK1 | 30-163 | NRKPQGRKKKNGPRPAKYHNWLTPFCWTQIVMVTKKVGWSASDIANGLKKLSPVVFGGINRNTIEGWIDRSGLKPKWKDSVLTRVRK… |
| A0A5E3XB60 | 135-291 | None |
| A0A4Z0A593 | 382-522 | None |
| A0A4Y9ZFH0 | 262-449 | None |
| A0A2H3CMA3 | 14-143 | None |
| A0A060T017 | 170-337 | None |
| A0A074SDA4 | 192-327 | None |
| K5XHG8 | 365-501 | None |
| A0A409YJ76 | 565-733 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.