DPCstruct | MC25274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 353 ± 59 aa |
| Standard deviation of domain lengths | 59.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9TTS2 | 334-585 | PSTEGLLPHGWTAHVHPEGALYYMHGETRTFTEVDICHQAIITDIELFQTSLFGELQRAISDQRVNLDLEDVELVLEPKADDYGVLC… |
| A0A409Y1Z8 | 49-423 | SFTIKPIETNFPGPVAEGSWTPYIHPEGVLYFYNESQAIPVITEVCIYDAKLRQLLESRVQDVLNYIRRYNIRMPSDIGLVLEYDRG… |
| A0A4Y9YNS7 | 421-872 | None |
| A0A0C3ERR6 | 14-299 | None |
| A0A0C3ATM0 | 373-797 | None |
| A0A166L6Q3 | 302-772 | None |
| A0A166HT69 | 2-312 | None |
| A0A166HBT8 | 1-266 | None |
| A0A165Y806 | 86-570 | None |
| A0A284QWN2 | 122-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.