DPCstruct | MC25273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 85 ± 11 aa |
| Standard deviation of domain lengths | 11.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D7VHG3 | 1-83 | MAYESSVPYRAGTEGYTSFRIPAVVRARSGTVLALAEGRVSSTADRGDLDLVRKRSTDGGRTWGPLRVVARNGTATAGNPPRE |
| E1M5K0 | 36-121 | LEKKLPEGAEITDKKDVFEAGKNGQSNPDGINSYRIPALLKTDKGTLIAGADERRLHHYDWGDIGMVVKRSEDQGQTWGDRITLTN |
| A0A4R2HZS9 | 83-147 | None |
| A0A4T2GLE3 | 151-250 | None |
| A0A139M9P0 | 325-417 | None |
| A0A4W5LDX7 | 58-133 | None |
| A0A137QJF9 | 28-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.