DPCstruct | MC25270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 167 ± 22 aa |
| Standard deviation of domain lengths | 21.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 47.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8IBV2 | 268-405 | MSFDQMWDEVVGAEAGEDRVYIAGWNDHFFVLKVEKEAIYLIDTLGERLFEGCNQAYILKFDRESRVFSKDLAADGGGGGAAARHLV… |
| A0A540LPM4 | 1-163 | MSFDDIWNEIDKNREFYEPRIYIVSWNDHFFVLKVEADAYYIIDSLGERLFEGCNQAYILKFDDSSIMHGKTEKAEDDSEERLEVIC… |
| A0A2Z7D8A6 | 564-738 | None |
| A0A7J6XGB1 | 1-121 | None |
| M1D650 | 73-235 | None |
| A0A4S4E1I3 | 268-424 | None |
| A0A0K9QQX4 | 419-604 | None |
| A0A287Q9M7 | 320-519 | None |
| A0A2Z7BPY7 | 120-266 | None |
| A0A4D9ASB3 | 305-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.