DPCstruct | MC2527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 138 ± 28 aa |
| Standard deviation of domain lengths | 28.31 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4Q507 | 70-174 | MHGYFIHIKLYNKIKAIQNPFEYEQYRAQLVQDAIKEQVSSRVSATAKTAVKTPKVNSKLAQRLEAKAIATEDDDKRAIAEQTTKSI… |
| A0A813JC38 | 1-116 | MDHRLHAKLKAALDPFAFEDYRKAKVKEKLEAKRTMRTKIRNKDKVEVNPSLHNQLQLAADEGDETGASKKRRETAEKAKRLLDDDR… |
| U6KKZ9 | 579-733 | None |
| A0A816WN61 | 833-993 | None |
| V5DQW6 | 5-188 | None |
| A0A086LLE6 | 520-624 | None |
| A0A7R8X6G8 | 781-941 | None |
| A0A182G8A3 | 1-159 | None |
| A0A2H9TQ22 | 45-168 | None |
| A0A4Y9YEU6 | 927-1146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.