DPCstruct | MC25267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 130 ± 20 aa |
| Standard deviation of domain lengths | 19.62 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 46.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540LEE0 | 19-164 | LLFLLLFSFLATSTTACSNGNCQVLEACAAATDCGPGLYCGNCPASGRNQPVCTRGQAIVPTSIINGLPFNKYTWLVTHNSFSIVDA… |
| A0A3M6TRZ3 | 154-260 | HPRLENERCSAGYTCADGLDCRLCDKPYATCQLSRVPSLTEQDYDRPFNKVAFLVTHNSFSHSPNFAVWARNQRFSVSQQLKDGVRG… |
| A2YQD2 | 1-108 | None |
| A0A6A1V6S6 | 2-113 | None |
| A0A1D6P894 | 21-124 | None |
| A0A446U553 | 5-148 | None |
| A0A6P8I772 | 151-261 | None |
| A2YYH6 | 8-143 | None |
| A0A3L6QLF5 | 12-154 | None |
| B9FDQ5 | 10-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.