DPCstruct | MC25266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 154 ± 25 aa |
| Standard deviation of domain lengths | 25.11 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061GP83 | 183-329 | ELSGYNPKRQEFDPEYDNDAEQLLAEMEFKDTDTEEEHEIKLRVLRIYSKRLDERKRRKDFILERNLLYPNPFEKDLTPEERALCRR… |
| A0A540L987 | 3-142 | ELSGYNFKRQEFEIEYDNDAEQILADMEFKDTDTNADRELKLRVLHVYANRLDERKRRKNFVLERNLLYPDPFEKGLAPEEREVYKR… |
| A0A653BPD0 | 28-189 | None |
| A0A2A2KJ28 | 581-761 | None |
| Q4N7P1 | 84-231 | None |
| A0A6I9YGU6 | 1-123 | None |
| A0A0C9RTN0 | 95-265 | None |
| S0F2V5 | 257-405 | None |
| A0A835XW87 | 338-486 | None |
| A0A1B0A939 | 114-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.