DPCstruct | MC25265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 145 ± 14 aa |
| Standard deviation of domain lengths | 14.36 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839VPQ8 | 369-516 | LENLCKSNPHLTLCKESKITANCISFSCEGDAILCAMTRLQYENACRTQEDRTSLEKAPYTSLGDQLLAGRDPLQDRLPTPQNGKTI… |
| A0A7V8L7N8 | 3-166 | QSKDDYCKNNADSAQCKGDSNGDGKDGGGSFGGSCEGGFTCEGDALQCAQLREQYKHNCETMGKDKDANSLTNKALNGTDDKSADAL… |
| A0A2G6YZJ8 | 327-453 | None |
| A0A272EVE2 | 262-416 | None |
| A0A4Q3J206 | 141-286 | None |
| A0A433BGZ1 | 307-445 | None |
| A0A7Y9FSU9 | 218-354 | None |
| A0A1G0AUU0 | 22-161 | None |
| A0A0E3BMS2 | 99-236 | None |
| A0A4V1LT86 | 191-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.