DPCstruct | MC25263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 184 ± 17 aa |
| Standard deviation of domain lengths | 16.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0282 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5JP59 | 21-217 | IVRRDAHKSEIAKRYRDLGEVNVKGLVLITFAQFLQKCPYEDHIKLVNEVVEFAKGCAADETAENCDKSLHQLFGDKLCSLPNFRER… |
| A0A5N4EFD3 | 28-209 | EYYLQNAFLVAYTKKAPQLTPPELMALTRKMAATGATCCHLSEDKQLACGEGAADLIIGQLCIRHEETPVNPGVGQCCTSSYANRRP… |
| A0A7J8JPS8 | 7-240 | None |
| H2ZZM2 | 136-338 | None |
| A0A668A0J5 | 187-369 | None |
| A0A7J7ZB95 | 398-605 | None |
| G3UIJ9 | 391-598 | None |
| S9WI87 | 498-667 | None |
| A0A3L7ILM4 | 242-410 | None |
| A0A4U1ENC7 | 35-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.