DPCstruct | MC25262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 10.55 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 50.40 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0105- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N4EAZ7 | 1-114 | MIQRSMMFEKVFENAIDPGAVADILESFLTRFELIQLVPPDTSFSESKSIFAFSTFFLVWEELAYYEENTRDFLFPEPKLTPHPGMC… |
| H2Y1M0 | 65-144 | FSHATDPVQIANALDGESVRIELVQLTYPGGELLATYEDSAREFLFPTPRISPTYPGVDREVLLQRSYSFPGIAPKLEFS |
| A0A6I8PR52 | 60-137 | None |
| Q5ZMP8 | 66-153 | None |
| A0A6J0U924 | 167-248 | None |
| A0A4W3HN33 | 12-93 | None |
| A0A498NJ21 | 304-394 | None |
| A0A5C6MS17 | 1-89 | None |
| A0A5N4EAZ0 | 50-132 | None |
| A0A3Q0CJF1 | 61-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.