DPCstruct | MC25258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 304 ± 52 aa |
| Standard deviation of domain lengths | 51.71 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 20.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3F4D7 | 25-278 | DVQNAKFILHFEDEPASVDMETVFSTEDARAYFEDFAASYEFPVNIKFATHIAADAMVSNATKTLLIKRNARFSQNQLLTLANHEIG… |
| A0A5N4DT71 | 385-703 | SPCMLVALRPTNMDYERDKFFQSQYTYNPQFEYQEPMPTAVLEKYCEASGQFIHQAVGIIEAVLEKFGTYEHFEAATGGQLLTKCQI… |
| A0A0V0QBS5 | 75-349 | None |
| A0A218V6R6 | 9-232 | None |
| A0A2C9K5G6 | 39-371 | None |
| A0A654GUH2 | 13-206 | None |
| A0A5C6ANG8 | 283-626 | None |
| L1JYY9 | 26-406 | None |
| A0A7S0NIA8 | 324-713 | None |
| A0A653HGL4 | 94-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.