DPCstruct | MC25257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 111 ± 10 aa |
| Standard deviation of domain lengths | 10.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05997 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813C2C9 | 1-104 | MAKDKGQEGLPVNFGKFLAHTDKVVRDRGFKRLKRWLVKHPELERLEYMKVWKGLYFAVWMADKRPVQQELAVNIALLLNDVPQERR… |
| A0A136J3B0 | 10-128 | FIKHLASSDRKIRTSALDTLRTFLSASASTARLTHTDNLKLWKGLYYSLWMCDRPVPQQNLCADLAGLLGTIAAAARRSGGGENAET… |
| A0A7N0SVA6 | 13-93 | None |
| A0A7J6SHK4 | 112-220 | None |
| A0A183H9Y1 | 2-119 | None |
| M9MES4 | 25-143 | None |
| A0A0N1H7Y9 | 83-217 | None |
| H9JNJ9 | 35-133 | None |
| A0A1X7UEP8 | 5-109 | None |
| C4YP49 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.