DPCstruct | MC25255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 180 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9EDH0 | 10-161 | QLVEAVSQEVALELSTPSGNSANKFRCCFCPFRSCGRADRLGKHIRKFHAKERLFTANGRTQAQWNLVLAMFEQEQATGNFLQRSAA… |
| A0A813BZI3 | 3-187 | DEDDVPVIRDGILERLQAEAETLAKRLSRRSLPVEGRHACPACPFRSFRERRQLRVHFAKYHSAKNQFVCSGTKQLKVILALSDHAA… |
| A0A812W4S3 | 1-178 | None |
| A0A812JF53 | 374-550 | None |
| A0A1Q9D8H8 | 44-237 | None |
| A0A812SD51 | 82-272 | None |
| A0A812TRR4 | 11-190 | None |
| A0A812RXK0 | 53-238 | None |
| A0A812RT19 | 323-499 | None |
| A0A812LIH2 | 121-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.