DPCstruct | MC25254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 212 ± 33 aa |
| Standard deviation of domain lengths | 32.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812J1G1 | 266-436 | RVLAIDNTSAASMCSGGPGSQRTRHLKIRAAFIREAVSEGRLEVRHTPGDLQLADLATKLQPRLRLWRLLSLWGFVGDRITEILNAF… |
| A0A1Q9F3Q3 | 98-297 | LSDSMSALTISSGTGSWRTRHLRIKASWLQEMLTAGSFTAKHCPGVVQPADLLTKALPSQRLCDLLELWGVGEVVDGDNKSKEVNTK… |
| A0A812Q0K9 | 377-582 | None |
| A0A812Y950 | 51-262 | None |
| A0A699KJS4 | 37-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.