DPCstruct | MC25253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 400 ± 80 aa |
| Standard deviation of domain lengths | 80.48 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813BVS5 | 126-511 | AAASVYYYNLDRFKFDAEQRQTCIYQVQSMRLAQWGLFREDVHDVFGLSTSSMDNYILVGALVVTAVMNFIFVGYPAFPPEPRWLLP… |
| A0A7J6PBW9 | 5-389 | EVGALLGGVWELFKYNRTNYQFDYELNQDRVYHTQKMRVEQVDLYREDVRDLFELTIGKMDTYIVVNTLTLGFVVGFFYEDLKMVLP… |
| A0A812PP60 | 277-708 | None |
| A0A812MA01 | 3-398 | None |
| A0A7S1XLL8 | 52-543 | None |
| A0A813DME0 | 484-946 | None |
| A0A812J4R8 | 2-352 | None |
| A0A1Q9DPJ4 | 119-551 | None |
| A0A812JNU4 | 13-472 | None |
| C5L2C7 | 5-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.