DPCstruct | MC25251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 418 ± 71 aa |
| Standard deviation of domain lengths | 70.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 66.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812XVI6 | 6-438 | DPPAWRAAVFLLKARAGGFMIAAPHLEDIISFFAAISEEAENQVDGPLPVVWKVVSVACETSRRRRVGEVPMVLADHLVYFRRGTAS… |
| A0A813BP51 | 4-436 | MLGPTHPAEVPSMVMSGPGLVTGDGRPVQVTFADLSVDALGRLSAYDPEGPPELLVAFDVGAPDLVPEPSALLTAAQTWTSDPDMAA… |
| A0A1Q9E4V6 | 24-534 | None |
| A0A1Q9EDM9 | 72-522 | None |
| A0A1Q9EM25 | 355-834 | None |
| A0A812QSL4 | 24-406 | None |
| A0A812ZF00 | 121-520 | None |
| A0A1Q9BZH7 | 358-816 | None |
| A0A1Q9C6Z2 | 538-1065 | None |
| A0A1Q9C946 | 53-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.