DPCstruct | MC2525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 359 ± 36 aa |
| Standard deviation of domain lengths | 36.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812NWE0 | 7-330 | LQAGTAVRAYYDMNDHPFGYRYVKMLEMPRDGPADSDPDPPVIGVSQGWIPATVAEDYDPKSNSGDGVLVKLHGFFEDAYREEKPVS… |
| A0A813J807 | 1-361 | MSMFRKGDEIYVFYRMGKRCRPERKYMAVLDSRHGAYRPRTGMSEGWLPARVTVDQDASRRGGEVCVEYLWPHFYTMRGNLTDPDNG… |
| R1CSP5 | 676-1042 | None |
| A0A812VKS4 | 205-609 | None |
| A0A813DU01 | 15-335 | None |
| A0A812U7K8 | 1-411 | None |
| A0A813B5K6 | 5-354 | None |
| A0A7S3JSI6 | 1-288 | None |
| A0A0M0JD60 | 1-384 | None |
| C5LWX0 | 312-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.