DPCstruct | MC25248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 303 ± 36 aa |
| Standard deviation of domain lengths | 36.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0CE20 | 11-278 | VFILIQTYLFEEVHSAASETLEVSLLPNGASVRCATGYNLSQEDCIREGIALGGHVKDDKFLGFWRHAPFGCSMASEGERIFFNTNR… |
| A0A813B1E2 | 59-353 | VGWVLGELHDTCNDYCQYTGYAGCDFERIVEINRIPRARRLLESLNYTCDVSDGDWNDVPTYRPDVGGCYYNRNALSCDANRREENQ… |
| A0A813B8E9 | 1-268 | None |
| A0A812KS51 | 13-291 | None |
| A0A812HS42 | 693-1023 | None |
| A0A812Y5G8 | 622-949 | None |
| A0A812UDQ3 | 81-411 | None |
| A0A812YGD4 | 1-209 | None |
| A0A7S0A9P9 | 1-365 | None |
| A0A812SMM6 | 143-447 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.