DPCstruct | MC25244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 13.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3L914 | 19-152 | LGEGDRLNCMFDALLCFHVSMNLNDFRCCCTAVCECLCIRHSACCLRGAPYKQVGLTTNTANGEYCRLSAPCCDCAIIPPRLLCGRA… |
| A0A813ADZ5 | 2-102 | TVYGACFCCFNGLNLENVEIGCAAKETLLCLEWDFCLKSNTEKLRCFCLDIRLVPVTVCIKQQGQMCCFVSAAAIPPDAEVPMMLSV… |
| A0A1Q9BZH6 | 685-806 | None |
| A0A1E7FI37 | 9-127 | None |
| A0A7R9WSN1 | 81-202 | None |
| A0A7S4NDR8 | 37-183 | None |
| A9P6Q6 | 11-109 | None |
| A0A812YYS7 | 6-118 | None |
| A0A812L9B1 | 542-664 | None |
| B5YNB3 | 6-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.