DPCstruct | MC25243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 284 ± 38 aa |
| Standard deviation of domain lengths | 37.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF10436- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812Q9C6 | 6-266 | IAKVDYRDELAGIKECLTGLGYCGPDQLDGFMISPIAKFWNANRSDPIVVYPGHCGIKQLHEPFARVGVADFKPCRRNSALIVPMRP… |
| A0A812ZP13 | 8-284 | DHGCRVQAVLYADGSGSVQQCKLQETLQETSEHTATALMQFFQELGYRQDSGYLIQSATKFWFENTMGDLTVFPQCLALQTVYDAMP… |
| A0A812HUM9 | 90-373 | None |
| A0A813DY56 | 133-351 | None |
| A0A812Q733 | 26-316 | None |
| A0A1Q9E7X7 | 327-640 | None |
| A0A812MY44 | 883-1198 | None |
| A0A812XBD5 | 103-414 | None |
| A0A813IBN1 | 82-447 | None |
| A0A7S1R2L2 | 16-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.