DPCstruct | MC25241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 239 ± 44 aa |
| Standard deviation of domain lengths | 43.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 94.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.10 |
| Pfam Score | 90.91 |
| Assigned Pfam label(s) | PF02013- CL0220- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A160NU65 | 597-806 | QAWSMERVAEYYQQTGDAQAKTVLDKWVSWALSKTTVNPDGTYRIPSTLQWSGAPDTWNATSPGANKSLHVSVADYTDDVGVAAAYA… |
| A0A3B8KRS5 | 1-307 | MQAWSMLRMVDLYLESGNKMAEELLDKWVPWVLDVTEVEDGGTIYIPSSLEWSGQPDSWTGRRSANSSLRVTVADKGQDLGVAGALA… |
| A0A5M3XN99 | 877-1102 | None |
| P22534 | 1524-1742 | None |
| A0A078KQR7 | 444-655 | None |
| A0LSI0 | 649-869 | None |
| A0A1Y1V2Y6 | 421-654 | None |
| A0A5M3XER1 | 520-736 | None |
| A0A1Y3MVC4 | 145-362 | None |
| R7MIV5 | 293-659 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.