DPCstruct | MC2524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 107 ± 0 aa |
| Standard deviation of domain lengths | 0.35 |
| Length coefficient of variation | 0.00 |
| Mean AlphaFold2 pLDDT confidence score | 88.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 70.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D6KPN7 | 777-883 | DLYPGDHIEIQWRRNKEFPYGWWYGVVGHLESCNGSENYCRCHKSDTVVLEFNHYTPGSRWRQTTVSRKDHREEGNEADGFYGGIRK… |
| G7KCV1 | 293-399 | DLHAGDHIEIQWRRNKDFPYGWWYGIVGHLESCDGNENYCRCHNSDTVVLEFNQYTSDSRWRRTTINRKDHREEGNEADGFYGGVRK… |
| A0A0E0JH54 | 422-527 | None |
| A0A7J7DNI9 | 87-193 | None |
| A0A0V0HHG1 | 112-218 | None |
| A0A2K3N0V7 | 127-233 | None |
| A0A835QSD8 | 155-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.