DPCstruct | MC25237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 247 ± 22 aa |
| Standard deviation of domain lengths | 22.41 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 45.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12779 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z0K0W2 | 35-286 | RNVLKRMLMAVFLCLFAVTSVFGQDGNYQDDQSSITVRAQQAPPPLPEYVQPQCPGDGYIWTPGYWSWRSNDYYWVPGVWVLPPEIN… |
| A0A562U4H4 | 173-412 | GTPANDAAVDNTAPVDTNLSVEAAPPPLPDYEQPECPQDGYLWQPGFWSYSPQRNDYYWVPGVWVAPPSPGLLWTPPYWGFVGHFYV… |
| A0A2V7XB08 | 1-292 | None |
| A0A495BKV9 | 22-224 | None |
| A0A3N1JQ78 | 21-268 | None |
| A0A5N7ZQZ8 | 42-280 | None |
| A0A2U3KT88 | 6-242 | None |
| A0A1V3Q8H2 | 19-279 | None |
| Q1IMZ8 | 59-343 | None |
| A0A2Z7A931 | 18-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.