DPCstruct | MC25232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 161 ± 24 aa |
| Standard deviation of domain lengths | 23.62 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.61 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0263- CL0053 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0VBB8 | 4-158 | AGLVCDRRLLQRYIRESFELEDRLSQCRMLPLLQQPVPLPLVGFNLREWATKTNPSKGKEVLLDLVKLVEGITAAQQELNQGCPSVL… |
| A0A6P5PVC5 | 6-191 | RPTRLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMEVEEQAIEVWQG… |
| A0A6J0V7G7 | 94-272 | None |
| A0A6P9AYB0 | 65-235 | None |
| A0A6J0W6A6 | 160-350 | None |
| A0A6I8RF59 | 3-177 | None |
| A0A6I9K5I6 | 4-173 | None |
| A0A3B3SKK8 | 16-186 | None |
| A0A151M5C9 | 5-136 | None |
| A0A5A9PMR9 | 236-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.