DPCstruct | MC25230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 67 ± 9 aa |
| Standard deviation of domain lengths | 8.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4LTE8 | 60-125 | KLRWLGVAGLLALAGCGHYQITLTNGHVLSARGKPRLDREFNIYRFKDAEGKEAMVPAFKVREIAP |
| A0A380MIQ7 | 14-76 | LSACTTMSFSDKHKLYEVRMMNGDSLYTRSKPQLDGDGYYRFDDVDNQHYIINDNLVLFIEAS |
| A0A839T205 | 9-76 | None |
| A0A833H9T9 | 1-83 | None |
| E1JRJ8 | 1-76 | None |
| A0A354EH80 | 2-79 | None |
| A0A355EXH8 | 3-74 | None |
| G5Q2D2 | 1-56 | None |
| B9XNY8 | 3-70 | None |
| A0A377C4Z9 | 10-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.