DPCstruct | MC25226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 170 ± 13 aa |
| Standard deviation of domain lengths | 12.71 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3IFU1 | 1-195 | MGREPGEVKPRGQPPQEPVFRAFHAPALYVYPINEYLQVNEDMAEPFNALKSVIEGATLPENIPFLPAFNAAQMFHSKEQILEFQNG… |
| A0A521I2B0 | 254-418 | PQVYVYAVDELKALDPSVAQNVEALQKILADGTVEADQQIPVFPIIPASQVFHAQTEILDFVNGTGVGFITYYAQDVSPIQSSRVFW… |
| A0A2E0L133 | 197-369 | None |
| A0A136P7I5 | 1-162 | None |
| A0A841I1L1 | 382-526 | None |
| A0A1F8MGQ1 | 159-333 | None |
| A0A521I350 | 336-506 | None |
| A0A521I0M3 | 485-651 | None |
| A0A7S8EBH0 | 282-465 | None |
| A0A399ZNF4 | 517-680 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.