DPCstruct | MC25223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 174 ± 43 aa |
| Standard deviation of domain lengths | 42.76 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9VI52 | 11-191 | EYDIVYRKKWQSMSYRSLPEDGRNLFDYLLTCPHRNTFGYFHLGDGAILDDLQWTAERLSIAWEVLLSHEDGDMVKRDPGARVVLLV… |
| A0A0Q6MIR9 | 4-144 | RDFSKISPAIWTSRRFLSLENDAKLQFIYYATNEHVNSCGVYRLKDAYAVDDLGFQLATYHQNRTMLISAQMIDFDSEHNFLMIEGW… |
| A0A442VQZ1 | 2-111 | None |
| B9XA30 | 8-158 | None |
| A0A4S0VU17 | 8-162 | None |
| A0A662Q1A8 | 2-202 | None |
| A0A351RVT8 | 1-154 | None |
| A0A7C1Q0C4 | 1-118 | None |
| A0A7C1QHM5 | 1-120 | None |
| A0A496PMR6 | 2-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.