DPCstruct | MC25220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 67 ± 8 aa |
| Standard deviation of domain lengths | 7.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 30.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9VAY7 | 1-64 | MAKFDLYRDVAGDYRWRFRAADGRVIAVSSQAYLHPAECKSDVELLKAQASEAVVDILGEPVSF |
| A0A0F9QRF6 | 1-58 | MGKFELWKDKKGEWRWNLVARNGQVIAVSEGYSSKAGAKNGIRSVRLNAPLARVVEKD |
| J7LQT3 | 84-158 | None |
| A5CLQ6 | 5-79 | None |
| A0A6J4HRJ7 | 1-72 | None |
| A0A2R6FMY3 | 9-81 | None |
| A0A644T617 | 13-76 | None |
| A0A418QNY4 | 112-182 | None |
| A0A133VPC4 | 3-60 | None |
| A0A343TP36 | 211-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.