DPCstruct | MC25212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 4.57 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 54.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419T840 | 9-87 | NHSVTFFVGENGTGKSTLLEAIAVAYGFNPEGGSLNHKFSSRNTHSQLYNQLLLSKSFYHPKDGFFLRAESFYNLASEI |
| A0A1F1XL19 | 37-115 | ITVLTGDNGTGKSTLVEALAGAFGLNPEGGGTGAMHATRRTESPLAEHLQLVRGAGAPRSGFFLRAETMHSLFTYYEEI |
| B0N7X5 | 4-82 | None |
| A0A535BUT3 | 45-118 | None |
| R2PYN7 | 37-112 | None |
| A0A6I2U801 | 243-317 | None |
| A0A2X2LST0 | 1-89 | None |
| A0A843DMT5 | 42-123 | None |
| A0A0D1JET1 | 32-117 | None |
| A0A285P2Q2 | 43-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.