DPCstruct | MC25207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 271 ± 32 aa |
| Standard deviation of domain lengths | 32.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12319 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8WQW4 | 3-185 | LLLKCKDDYPNFKCSAYGDTREWLDNKRDDFEKYKNILERKWKHYKGNLQSTNAKKSMNDCSKWSKEDWENWMKDKGFDFMNQQVQS… |
| A0A1A8WHK8 | 6-240 | GAIEETETLKNCAWQNWMMRLESDWEQFNASMNIRKDEWLKEAEAEWDEWIKSIKNKWMNCNEYMDIEIKSDILSKSSTWNETQWKE… |
| A0A1A9APN6 | 111-407 | None |
| A0A1A8YLZ7 | 15-271 | None |
| A0A1A8YQZ1 | 290-606 | None |
| A0A1A9AMV3 | 15-321 | None |
| A0A1A8YLU5 | 61-341 | None |
| A0A6V7RXL1 | 56-320 | None |
| A0A1C3KUP3 | 322-624 | None |
| A0A0J9SIF8 | 28-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.