DPCstruct | MC25204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 228 ± 43 aa |
| Standard deviation of domain lengths | 42.53 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03839 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T3BB79 | 96-318 | ALAVAAFLKSQDLKMRTCILNGQRKDMFKVKRALRALQSPAYEKARKKNPLLPEITDRASLENTFKLLPMSLLALRVSKIDPHEGHG… |
| A0A1M8A805 | 11-205 | QRADYFKGSAAVKAVLSPEYKKLKNVPQVETEEEAERMLHSLLPFAFFLRVERGPAPPSTSKDHAAPRPLKVIHMQMFEKDMHYVWL… |
| A0A154PH87 | 79-360 | None |
| A0A6V7PNX5 | 27-194 | None |
| A0A177WM14 | 2-144 | None |
| A0A6G0X5I9 | 12-242 | None |
| A0A2G8L532 | 18-296 | None |
| A0A183WXY5 | 32-208 | None |
| A0A0C2JMJ8 | 17-233 | None |
| A0A7M3RGV4 | 73-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.