DPCstruct | MC2520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 167 ± 10 aa |
| Standard deviation of domain lengths | 9.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7CA91 | 51-222 | EEDVPQVRCDWYVFAFLSSLPWVGKELYEKKDAEMDRILSQTESYLKRRQKIHVPMLQVWSADKPHPQEEYLDCLWAQIQKLKKDRW… |
| A0A183AS37 | 1-169 | MLASHDASALNDILGTIDVYMTKRQKAHVPLLRVWESDDPHPQEDYLDCLWAQIKNLRSAGWQEKVTWRLYDSFPGLKEAGQPHHLP… |
| A0A2R7W6H1 | 91-252 | None |
| A0A2A2K1X5 | 299-473 | None |
| A0A813Y6I9 | 231-406 | None |
| A0A1D2MV56 | 206-372 | None |
| A0A4Z2D3W5 | 166-351 | None |
| A0A5E4NGQ3 | 6-156 | None |
| A0A0N4YK42 | 365-537 | None |
| A0A183GD93 | 5-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.