DPCstruct | MC252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 159 ± 18 aa |
| Standard deviation of domain lengths | 18.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0Y445 | 2-116 | GHLLGTADMIAQMADRCYLEKCRDRLYLEFVLGGVALPVSASGQTEVKYASGLDLLRQTPQFVDEVRIKRLDGQFGAVYRHIEILYN… |
| A0A3N5N959 | 21-204 | NGAEYTKVHVSRGGRFLRDYLHKIGMAKFAEAAAPTLHFTGYEQAAERIRVPDPVFRLIGNMLGSADIIAQMSDRCYLEKCYERLYP… |
| A0A127F952 | 103-268 | None |
| A0A1F9PVD8 | 118-291 | None |
| A0A1W9MG24 | 522-700 | None |
| A0A847A0G6 | 2-136 | None |
| A0A2N2KHM2 | 222-373 | None |
| A0A7C1C6F8 | 393-554 | None |
| A0A3E1DX93 | 127-277 | None |
| A0A2D6PBI6 | 2-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.