DPCstruct | MC25198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 8.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 51.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0IRB2 | 1-87 | LAFSLTLDSVEITSLDFVAPDEEVFDYWTDGINALLGNKMTSKEADNDLETLLSMEIKIRLLDAEGVEIPHHPPEVPEEPRNYDFNF |
| Q5FVI2 | 1-103 | MKEKSALKQNKEVLELAFSILYDPDETLNFIAPNKYEYCIWIDGLSALLGKDMSSELTKSDLDTLLSMEMKLRLLDLENIQIPEAPP… |
| A0A6F9CQH6 | 252-354 | None |
| A0A7E6EIB2 | 66-144 | None |
| A0A7R8HDV3 | 118-207 | None |
| A0A2P8Y6L4 | 921-1006 | None |
| A0A6P9AF91 | 853-941 | None |
| A0A6A4TE37 | 896-991 | None |
| A0A315V856 | 205-306 | None |
| L5M970 | 125-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.