DPCstruct | MC25195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 148 |
|---|---|
| Mean domain length (aa) | 149 ± 28 aa |
| Standard deviation of domain lengths | 27.93 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 18.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A358XZY9 | 1-107 | MTPKQTIFFHEYLRDLNATRAARDAGFAHPNVQGSQILAKPHIRKRIAEAILERSERLKLDADWVVSQLEKEATDQSNGSAVRVRAL… |
| A0A8B3UHM5 | 2-150 | AKLTDKQELFAREFIKDLNATQAAIRAGYSEKSSRNQGARMMANDDILHRIAELNQERLERVQVDADYVLRQAVKLHERCMQEVEPL… |
| A0A441DBU9 | 66-220 | None |
| A0A1N7P5W5 | 19-184 | None |
| A0A642MGN0 | 3-174 | None |
| A0A0F9F9T1 | 9-146 | None |
| A0A378MYX0 | 11-140 | None |
| A0A497P7F3 | 5-172 | None |
| A0A1V5ZIG8 | 4-118 | None |
| A0A532DTY0 | 3-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.