DPCstruct | MC25193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Standard deviation of domain lengths | 3.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 55.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B3HP89 | 1-56 | LAHTQNAFIWRFIIVNPSDSRVVHVVASTEQEARNRCPSGCVAVFAARIRQGVSHA |
| A0A7Z3MET0 | 3-62 | DHITHPQGRKSYIWRFLALSAIGRNVIHITATTEREAREQSPAGCVMVFAGRLPVEVRHA |
| A0A6L9C4T6 | 333-391 | None |
| A0A2A2CDR0 | 140-199 | None |
| A0A829ILD7 | 271-322 | None |
| A0A3L2NWR7 | 216-277 | None |
| A0A454SMZ6 | 355-413 | None |
| D2ACY7 | 37-99 | None |
| A0A827YCC6 | 527-580 | None |
| A0A823BKJ3 | 400-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.