DPCstruct | MC2519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 143 |
|---|---|
| Mean domain length (aa) | 414 ± 72 aa |
| Standard deviation of domain lengths | 71.99 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 13.93 |
| Pfam Score | 76.04 |
| Assigned Pfam label(s) | CL0023- PF08385- PF08393 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6R378 | 37-344 | LMTGFITKSVKELEEFLKSTDAGISAKLNAGDVRALIRVKNYIKTMYEEEANLILKQDEILESLGALQREGLPNEKALKQLKKTWDS… |
| A0A183APA1 | 8-441 | LMLNSALAFERLIKSPHGQIRGSSEEPNKGITWDRLEEVETYISQLQAASRQLMSENRKLRKVHFAIVEKIVRLLDVDLLRNQPRWR… |
| A0A2V2VND5 | 618-1032 | None |
| A0A3Q0JGM1 | 394-713 | None |
| A0A7S4P4G7 | 244-747 | None |
| A0A1A9XJL4 | 147-631 | None |
| A0A5B7DTZ9 | 37-574 | None |
| A0A6P8HSI5 | 81-546 | None |
| A0A3S0Z6K6 | 33-349 | None |
| A0A821UR53 | 257-688 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.