DPCstruct | MC25189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 180 ± 30 aa |
| Standard deviation of domain lengths | 29.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 21.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2YLS3 | 1-145 | MATYLFVENGEIIPITRYGNVDKFIGTMKKVYDDASKGSKSKAKLRLASALRYVKFSFLRKHVWRVLREGSYEALGDLQRRSILLSA… |
| A0A550GBZ8 | 14-191 | VSDFYPVPVVVPVSKAVGALKDKRYVEFTAHPHCGMATFVFVEEGKLKPVTRYGNIEKFRGSLEKVYLDAAKGSKSKAKLRLVGSAR… |
| A0A535VLP0 | 2-176 | None |
| A0A523DUL9 | 222-412 | None |
| A0A497HPL9 | 178-367 | None |
| A0A7C0XNR2 | 1-111 | None |
| A0A1W9WAM9 | 74-244 | None |
| A0A645J7D2 | 12-134 | None |
| A0A2J4JFQ2 | 281-469 | None |
| A0A2V8NSG9 | 2-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.