DPCstruct | MC25185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 292 ± 65 aa |
| Standard deviation of domain lengths | 65.10 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 75.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067M238 | 13-215 | VVGSGVTFSISSALKKNIRKYGIAALLTPNLSRYYKGPCVKVVLDIIKAHRFDLPPDIEKDRARWQLVESEVKEQLTSLKGTMKNTL… |
| E3L9L6 | 25-339 | ETDEYVPWPPRRETDIVRRPDGKLVGLVETNQIYSDLIDRLAHTPPDDRWRISIMMMTNILQRLSIGDGETGPPAIVPHQYSSALRT… |
| A0A180G1H2 | 41-331 | None |
| A0A180GBP1 | 16-288 | None |
| A0A180GCD6 | 136-481 | None |
| F8PHF1 | 75-357 | None |
| A0A4Y9XZ43 | 43-378 | None |
| A0A2N5VH65 | 3-236 | None |
| D6RQK3 | 13-460 | None |
| A0A0D0CPU5 | 3-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.