DPCstruct | MC25184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 196 ± 46 aa |
| Standard deviation of domain lengths | 46.12 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4NUF0 | 136-262 | PLRPVKTITMQMELLLKEYLSSRDVAEAQRCLRALEVPHYHHELVYEAIVMTLESLSQTTEEAMCELLKQLDLTCLVLPAGMEQGFL… |
| E3L7Q5 | 16-185 | SDHPAPKINLSERSQLGIKPPLIYQAPLADTDEQAERAIKSRVDEFFHVRSVAEAAASFVSLSQTRHHQLIHSLVEKTLEKKAADVD… |
| A0A2H3D7S4 | 215-396 | None |
| A0A068UP38 | 4-178 | None |
| A0A820DUZ0 | 7-249 | None |
| A0A2H3BT33 | 658-794 | None |
| A0A2W1BBL9 | 23-170 | None |
| A0A284QNE1 | 640-812 | None |
| A0A6V7WPR2 | 2-130 | None |
| A0A2H3CZF8 | 376-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.