DPCstruct | MC2518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 139 ± 4 aa |
| Standard deviation of domain lengths | 4.24 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 75.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183TGX5 | 706-844 | LKVGRVVRQYFHVPISYDFVVTPYSKDRQLLRLEEECKCLVNLLHPDDPRSMYCPAGYRTIEVLYDEEAGKFETFHHRLNRILSPRR… |
| A0A183AN24 | 1-141 | LKIGHVARQYIHVPHSCDYLVTPYTKSRQLLRLEEDCGCIVNLIHPEDPRAIYCPPGYRTIEVVYDEDRGRHDLFLHRLNYIINPRR… |
| A0A3P7LPB8 | 86-227 | None |
| A0A3P7MGH8 | 32-163 | None |
| A0A7M3RRK0 | 269-403 | None |
| A0A183AZS8 | 4-142 | None |
| A0A4S2M7H2 | 510-643 | None |
| A0A0R3W4B1 | 91-234 | None |
| A0A068WPG6 | 906-1051 | None |
| W6US00 | 210-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.