DPCstruct | MC25177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 102 ± 17 aa |
| Standard deviation of domain lengths | 16.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.37 |
| Pfam Score | 86.35 |
| Assigned Pfam label(s) | PF02751- PF02268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W3VRJ5 | 2-92 | QLTDALDELIQSGHINPVLAMRVLNEFDKSIATNLAKNVKAKSQLKGHLKDYRLCEEVWTFRVRNATLKLDNAELLDVDKVKIVACK… |
| A0A2I2YZD9 | 4-90 | QLYRNTALGNSLQVILLQFDKAINSALAQRVRNRVNFRSFLNMYRFCDNLWTFILNDVEFREVTKFIKVDEAKIVDCDDKITGSNTT |
| A0A226ER87 | 106-222 | None |
| Q9XG36 | 4-104 | None |
| A0A168AJL2 | 19-143 | None |
| A0A7S3N4E2 | 17-124 | None |
| A0A2U1J2T4 | 5-111 | None |
| A0A7M3RSX9 | 13-116 | None |
| A0A094GXF6 | 8-117 | None |
| A0A1E5RXD6 | 5-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.